N-Glycosylated Protein Data

Protein Summary

ID: type II transmembrane protein
Protein name: type II transmembrane protein
Protein Symbol:
Protein Function:
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
2300 (F)SQPAQNqTQLHDGTASF(T) Chymotrypsin 915.92 1829.82 2 95% 31.56 32.16

Protein Sequence

mtmksmkysdcdtimdgynpvppplprrvppvrniyaepfahepnhssrlgghpqqmpqs
mstgsntighggidrggvglpmgagtmpggvgggpggvagggpqvgvgppgsgnggncqi
sgsqplvmpgfplrnshsahaphyspyspsrfhidkrcqhrcswkclsialifvsvvlta
mlayfaavssmkpnmdstncilvqdvksqphdlrgglaksnekgvatafpteesiqtsts
dhgqnghglmnpsagsggsnsgiqqqlllqqqqphsinqpltpldatnthlqdhhqltyg
galpggvggigmsgggimngglngglggqlmqqpggglnghhhqalqpqlggvvelkefn
eayhatipayqfwtlefrnkhpafirfnftlpwgahfavysrrnvapsvtqhdfvefikg
grldshlrhrrssanatttgqdmelyrqdkdqsaesaqdqdseqdesrsfdssesydvet
pldtakqhlqrigkpqshwvnkrsagdglpaldvdamtvnvsllqyldtglwfisvynde
lvahsvsllaeeaegvsttcpndcsgrgscylgkcdcidgyqgvdcsksvcpvlcsahgh
ygggvchceegwkgaecdipvgecevpncsshgrciegechcergwkgpycdqhdcldpl
csghgtcvagqcyckagwqgedcgtidqqvyqclpgcsehgtydletgqcvcerhwtgpd
csqavcsldcgrngvcesgkcrcnsgwtgnlcdqlpcdsrcsehgqckngtcvcsqgwng
rhctlpgcengcsrhgqctlengeyrcdciegwagsdcsialelnckdnidndgdgmtdc
sdseccshpacsehimclssndpvevllrkqppsvtasfyqrvkflieensvqsyahmde
ysenrvsvmrgqvitpqglgivgirvsvdrdsrfgftltrqggwfdvlvngggavtlqfq
rspfrpltrtvfvpwnrivvlppvqmqlsdddettsrnikvaplnpaltflnsihyhtad
eandaskvcmdhdheklrpqlistwmpngvgampgkrvifaetqivqesiqipgsdlhlt
yqssqasgylsivrmrltgetipptlthvhvgveiegalhvktyeadpslvhtfawnkrn
vyrqkvygvtvarisvgyqhstcqspvwiaqtaklqgydvdisdiggwgldihhhynfhe
gilqkgdgstlhmkeyprtvkvvmgtglqrpltcpdycngvakdaklltpialatgpdgs
lyvgdfnlvrritpdgkvytilqlsatqvsyqyylavspadghlyisdperhqilrlvrl
ekvkdpsinsdpvvgsgqrcipgdegncgdggpallarlshpkglaiaadrtmyiadgtn
iravdpkgvihtlighhghhnhwspapcsgtlmanqaqlqwptglalspldgslhfiddr
lvlrltsdmkirvvagtplhcsnggqdgrvnktgadnvlgtvlamafspfgnlyiadsds
rrvnsirvvdtagnmryfagkqegtgsqtcdcaigggsngsatnsgvggasgsaysttvn
ptrpnggttpttpsggngngngngssatssggsvggsngsggganggacicaggialstg
tgsssgsngggtlasivgsgglmstgptttttvllgakttaagigaatlnddgtlsnaet
llssnarfqaisaiavaqdgvinvadqgslhvlalehylpshdengefhipfppsseiyv
fnrygqhvatkdltsgktrysflyskntsfgrlstvtdasgnkiqflrdysnvvssient
qdhkseiqingigimtklsekgrqeieldydsntgllnsrssggetyiyqydefgrvtgm
ilpsgeivritsqladsqgltvyvhasveslfsreriageanellvlggvrstflkrgqa
hadaelkanntlvihgdngvvveasavarhplleaalpveaemlamwshqsvtmgegltn
smysvyslvgdvrnpqqtlnreiwvnqsrvigvefdqftnretfydarrtpilivaydqs
glpksyyptngypvnitydrfnrvegwawgpaelkysydrhgllseitsqqdgivsfvyn
dwnlvseiglasqrkfvlqyddagglrhvvlpsgtrhsfsmqtsigfirctytppgstra
ylqhyshagallqtilpgdgarivyrynaagqltevvhgdgrsefqyneatgmpstvsht
ereleyrwdfeyaagllaeeridyvaktglsnakfsyeydsqlrvvalqgriggqslptq
afaydprtgrpsligqfr[fSQPAQNQTQLHDGTASFt]rtvdgrfqtqrmalaihrlev
frmefsygvhgrisqtrtytrnmavnsytnvknytwdcdgqlvgveaqepwgfryddngn
llsltyrgntipmeynaqdrivkfgegqykydarglvaqnareerfhyntqgllvraskr
grfdvryyydhlkrlttrkdnfgnvtqffytnqqrpyevsqiysprdgklmsltyddvgh
liyaqvyrhkyyvatdqsgtplmlfnqygegireimrspfghivydsnpylylpidfcgg
ildqvttlvhmgdgrvydpligqwmspdwqrvaeriitptrlhlyrfngndpinvgherh
ypedfaawmrtlgynvgnlvpqlardlwqppalwgrppanpvalnlrrpfdniptmaves
gflahlnvrrmsdfeqlsapprsalkcdvmdpspktigsdteppfgkgivvsrtadgqai
vssvpaanaiyrdvytsvfnrskllpftfvvhnaqqdsfffvkedawratedrqqlkrlq
gqvnttfheitreatvgsgpagaanggagsssssssssgggsssntgnyldvkihgahai
inlrygttvakeqqrlmhhakltavrkawhrekealrsglttalewsqqetdeilkqsya
nnyegeyihdvnlypelaedpynikfvkkkgatggaagvpnsrrrrrrstdliqeeeeel
hreadc

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University